PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00932g02001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 147aa    MW: 16391.3 Da    PI: 4.7256
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00932g02001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF24.92.7e-08250149
                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                              k+i ++  r  tf   +  i+K  +ELSv ++a v v+++s++gk y y
  Peinf101Scf00932g02001.1  2 KKIADEAIRLATFLLLKSIIFKEVHELSVTTGAVVGVLLYSPNGKPYVY 50
                              567888889999999999**************************98877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001201.78E-12153No hitNo description
SuperFamilySSF554553.14E-12175IPR002100Transcription factor, MADS-box
SMARTSM004329.9E-4153IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.895154IPR002100Transcription factor, MADS-box
PfamPF003191.1E-10350IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MKKIADEAIR LATFLLLKSI IFKEVHELSV TTGAVVGVLL YSPNGKPYVY GSPGSFDTNT  60
NRFLNENPYD CKNNHGMAAS NREQERAWLD AESIRLDELK KKLESELQKR LTPVSSTTFP  120
TSTEASHVTN DLDVVSDPDD EEKSEAN
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14083711
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29962.13e-11AGAMOUS-like 64